On the top right corner of the Connection Views you will find its menu:
![Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar](connviewtoolbar.png)
The Connection View menu includes:
![Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Keypads Button Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Keypads Button](connviewsettingsdisconnectbutton.png)
|
Disconnect
Disconnects the session.
|
![Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Keypads Button Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Keypads Button](connviewsettingsselectkeypads.png)
|
Select Keypads
Click to see all keypads enabled for this connection. This option will not be shown if no keypads are enabled for the connection.
|
![Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Macros Button Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Macros Button](connviewmacrosrecordbutton.png)
|
Record Macro / Save Macro
Click on this button to record a new macro sequence. When you are done, click on the 'Save Macro' button that you will see in its place. Read more: Creating a Macro.
|
![Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Keypads Button Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Keypads Button](connviewsettingsmanagemacros.png)
|
Manage Macros
Click on the Macros icon to see the existing macros. It is shown only when there macros for the current connection. You will be able to rename and delete the existing macros.
|
![Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Keypads Button Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Keypads Button](connviewsettingsprintscreen.png)
|
Print Screen
Send a screenshot of the session to the printer. You can choose 4 different printing modes.
|
![Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Keypads Button Web-based HTML5 TN3270 IBM Mainframe TN5250 IBM AS/400 VT UNIX Terminal Emulation Connection View Context Toolbar Keypads Button](closetoolbarbutton.png)
|
Close
Closes the session.
|
The macros recorded for this session will be shown in the Connection View Menu:
![](macro1.png)
Select the macro to run it.
Keypads enabled for this connection will also be shown in the Connection View Menu:
![Web-based HTML5 TN3270 TN5250 VT100 Terminal Emulation Keypad Enabled PGUP PGDOWN ENTER RESET ERASEEOF ATTN SYSREQ HELP FUP FIELDEXIT Web-based HTML5 TN3270 TN5250 VT100 Terminal Emulation Keypad Enabled PGUP PGDOWN ENTER RESET ERASEEOF ATTN SYSREQ HELP FUP FIELDEXIT](connviewkeypadsmenu.png)
Read More:
|